PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023736m
Common NameCARUB_v10023736mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 300aa    MW: 33263.8 Da    PI: 5.4341
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023736mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.28.8e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + + ++   +W ++a++++ g+t  +++  ++ 
  Carubv10023736m 28 KWTAEENKKFENALAFYDKDtpdRWFKVAAMLP-GKTVGDVIKQYRE 73
                     8********************************.******9999986 PP

2Myb_DNA-binding48.61.9e-15142186347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ Iar + ++Rt+ q+ s+ qky
  Carubv10023736m 142 PWTEEEHRQFLMGLKKYGKGDWRNIARNFVTTRTPTQVASHAQKY 186
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-42374IPR009057Homeodomain-like
PROSITE profilePS512939.5612479IPR017884SANT domain
SMARTSM007172.1E-102577IPR001005SANT/Myb domain
SuperFamilySSF466891.15E-112781IPR009057Homeodomain-like
CDDcd001672.37E-82874No hitNo description
PfamPF002493.2E-72873IPR001005SANT/Myb domain
PROSITE profilePS5129421.845135191IPR017930Myb domain
SuperFamilySSF466891.66E-17137190IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-18138190IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.7E-13139186IPR009057Homeodomain-like
SMARTSM007178.7E-14139189IPR001005SANT/Myb domain
PfamPF002497.8E-13142186IPR001005SANT/Myb domain
CDDcd001677.76E-12142187No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MNRGIQVMSP ATYLETSNWL FQENRGTKWT AEENKKFENA LAFYDKDTPD RWFKVAAMLP  60
GKTVGDVIKQ YRELEEDVSD IEAGLIPIPG YASDSFTLDW GGCDGAAGNN GFNMNGYYFA  120
AAGGKRGSAA RTAEHERKKG VPWTEEEHRQ FLMGLKKYGK GDWRNIARNF VTTRTPTQVA  180
SHAQKYFIRQ VNGGKDKRRS SIHDITTVNI PDSPDAAATD NATSNAPCSP PSVGGGSQQE  240
ASEWEGQPLY DETAAAFYNQ NAFQETLLGM SSTPYMAKLQ EQSFLNASHF EPYNAYLQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A7e-172693875RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1181350.0AK118135.1 Arabidopsis thaliana At2g38090 mRNA for putative MYB family transcription factor, complete cds, clone: RAFL19-43-J04.
GenBankAY5195290.0AY519529.1 Arabidopsis thaliana MYB transcription factor (At2g38090) mRNA, complete cds.
GenBankBT0061220.0BT006122.1 Arabidopsis thaliana clone U50930 putative MYB family transcription factor (At2g38090) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294698.10.0hypothetical protein CARUB_v10023736mg
SwissprotQ8S9H73e-95DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLR0FXY90.0R0FXY9_9BRAS; Uncharacterized protein
STRINGAT2G38090.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122827100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-176MYB family protein